PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010099299.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 332aa    MW: 37601.4 Da    PI: 7.0118
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010099299.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like802.7e-25187241256
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     +r++Wt eLH++F  a++ LGG++ AtPk+i+e+m vkgLt +++kSHLQk+Rl+
  XP_010099299.1 187 TRRHWTDELHAKFKLALSILGGPKAATPKQIREVMCVKGLTTDQIKSHLQKFRLH 241
                     699**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.371183243IPR017930Myb domain
SuperFamilySSF466892.15E-16186243IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-22187243IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-22188241IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGSISNSPNS LELGLSLKPS YVPKTISDLL SDLAKIDNIR EKLSVLNDYL KKYEEELSWV  60
VPFRRELPQC VLLLMEAIEI MKGEITKLTK NNGGEESEFD GQRRFNEFLK RKRSIYDNEE  120
MNISPPWSAY QENRTDHKET ANLSPESQKI PRIESNSFGT RLKANQSCAL EIRQQDPFSD  180
PTWKISTRRH WTDELHAKFK LALSILGGPK AATPKQIREV MCVKGLTTDQ IKSHLQKFRL  240
HMKADGGSKN QMNGEDHNPA VGAPYDQSNN HTGIWVPRAQ VMHLYAPNMA QAQTSTAIND  300
QQNDVVTTND INSDDGNFAG WLNHISLCGT QF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010099299.10.0Myb family transcription factor APL
TrEMBLW9RK580.0W9RK58_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF148661012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-29G2-like family protein